Cagri is a new long—acting amylin analog with N-terminal lipidization, which increases its half-life by binding to albumin. This synthetic peptide mimics and enhances the action of natural amylin, while simultaneously affecting a variety of metabolic pathways and appetite regulation mechanisms in both homeostatic and hedonic systems.
Cagrilintide is a peptide bioregulator of appetite and satiety that works through the amylline pathway of regulation of eating behavior. It occupies a special place in modern strategies for metabolic health, fat loss and active longevity, especially as an enhancer of incretin peptides.
General information
| Features | Values |
|---|---|
| The peptide sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| The molecular formula | C194H312N54O59S2 |
| Molecular weight | 4409 g/mol |
| CAS Number | 1415456-99-3 |
| PubChem CID | 171397054 |
| Synonyms | 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N |
Lyophilized peptides
Our Cagrilintide is supplied as a freeze-dried powder. This process prolongs the shelf life and preserves the purity and integrity of the peptide without the use of any fillers.
Product Usage
This product is intended solely for research purposes. All product information provided on this website is intended for educational purposes.
The purity of peptides is more than 99%
Confirmed by certified laboratories. The analysis certificates are available before purchase.
GMR Production Standards
Manufactured in enterprises in accordance with good manufacturing practices. Complete documentation on tracking the origin of the product.
Execution of orders at the highest level
Sending orders the next day at checkout before 12:00 Moscow time. Free standard shipping across the country for orders starting from 15,000₽ (or equivalent).
Without fillers and additives
Only pure active connections. The composition is confirmed by experts for reliable in vitro studies.
Cagri is a long—acting amylin analog developed to eliminate the disadvantages of existing amylin analogues such as pramlintide, which have a short half-life. Cagrilintide is designed to be more stable and lipidated to increase the duration of its action. It has shown significant potential in weight loss both as an independent treatment and in combination with GLP-1 analogues such as semaglutide. Cagrilintide is a long—acting amylin analog developed to eliminate the disadvantages of existing amylin analogues such as pramlintide, which have a short half-life. Cagrilintide is designed to be more stable and lipidated to increase the duration of its action. It has shown significant potential in weight loss both as an independent treatment and in combination with GLP-1 analogues such as semaglutide.
Effectiveness of weight control and obesity treatment
Clinical studies have shown that cagrilintide effectively reduces body weight in obese people. In the phase 2 study, cagrilintide resulted in greater weight loss compared to placebo and liraglutide, with the highest dose providing an average weight loss of 10.8%. In combination with semaglutide, cagrilintide has demonstrated enhanced weight loss and improved glycemic control in people with type 2 diabetes. A meta-analysis of randomized controlled trials also showed that this combination (CagriSema) resulted in significantly greater weight loss compared with the use of semaglutide alone.
Comparative studies
Cagrilintide has been compared with other amylin and calcitonin dual receptor agonists (DACRA) such as KBP-336. Although both drugs demonstrate efficacy in weight loss and glucose control, KBP-336 has shown superior long-term efficacy in preclinical models, indicating differences in receptor activation balance. Combination therapy with cagrilintide and other drugs such as tirzepatide has shown promising results in enhancing weight loss and reducing food intake, highlighting the potential of combined approaches in the treatment of obesity.
Health of the cardiovascular system
Amylin-based therapies, including cagrilintide, are being studied for their potential benefits for the cardiovascular system, such as vasodilating, anti-inflammatory, and anti-atherosclerotic effects. These drugs are analyzed for their effect on blood pressure, lipid profile, and cardiovascular markers. Amylin analogues may offer innovative approaches to improving metabolic and cardiovascular health, potentially reducing the global burden of cardiovascular disease.
Glycemic control
Cagrilintide controls hyperglycemia through various mechanisms. In a phase 2 study involving obese and type 2 diabetic patients, CagriSema reduced glycated hemoglobin (HbA1c) levels. After 32 weeks, the decrease in HbA1c levels with CagriSema was statistically significantly higher than with cagrilintide alone, but did not significantly exceed semaglutide. Another study combining semaglutide and cagrilintide showed that CagriSema improves glycemic control.
Links
1. Lau, D., Erichsen, L., Francisco, A., Satylganova, A., Roux, C., McGowan, B., Pedersen, S., Pietiläinen, K., Rubino, D., & Batterham, R. (2021). Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. The Lancet, 398, 2160-2172. https://doi.org/10.1016/S0140-6736(21)01751-7.
2. Enebo, L., Berthelsen, K., Kankam, M., Lund, M., Rubino, D., Satylganova, A., & Lau, D. (2021). Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2·4 mg for weight management: a randomised, controlled, phase 1b trial. The Lancet, 397, 1736-1748. https://doi.org/10.1016/S0140-6736(21)00845-X.
3. Larsen, A., Mohamed, K., Sonne, N., Bredtoft, E., Andersen, F., Karsdal, M., & Henriksen, K. (2022). Does receptor balance matter? – Comparing the efficacies of the dual amylin and calcitonin receptor agonists cagrilintide and KBP-336 on metabolic parameters in preclinical models.. Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 156, 113842 . https://doi.org/10.1016/j.biopha.2022.113842.
4. Valdecantos, P., Rada, P., Ghosh, S., Rondinone, C., & Valverde, A. (2024). 300-OR: Beneficial Effect of the Combination Therapy of Cagrilintide, a Dual Amylin/Calcitonin Agonist, and Tirzepatide, a Dual GLP-1/GIP Agonist, on Body Weight Loss in Obese Rats. Diabetes. https://doi.org/10.2337/db24-300-or.
5. Badshah I. Unlocking the Potential: Amylin-Based Therapies as Novel Interventions for Addressing the Nexus of Obesity and Cardiovascular Health. J Endo Metabol Res. 2024;5(1):19-35. https://doi.org/10.37191/Mapsci-2582-7960-5(1)-036
6. Mikhail, N. (2023). Cagrilintide Combined with Semaglutide: a new Approach for Treatment of Obesity and type 2 Diabetes. Clinical Research and clinical Trials. https://doi.org/10.31579/2693-4779/154.
7. Frias, J.P., Deenadayalan, S., Erichsen, L., Knop, F.K., Lingvay, I., Macura, S., Mathieu, C., Pedersen, S.D., & Davies, M.J. (2023). 53-OR: Efficacy and Safety of Coadministered s.c. Semaglutide and s.c. Cagrilintide in Type 2 Diabetes. Diabetes. https://doi.org/10.2337/db23-53-OR.
8. Dutta, D., Nagendra, L., Harish, B., Sharma, M., Joshi, A., Hathur, B., & Kamrul-Hasan, A. (2024). Efficacy and Safety of Cagrilintide Alone and in Combination with Semaglutide (Cagrisema) as Anti-Obesity Medications: A Systematic Review and Meta-Analysis. Indian Journal of Endocrinology and Metabolism, 28, 436 – 444. https://doi.org/10.4103/ijem.ijem_45_24.