Cagrilintide is a peptide bioregulator of appetite and satiety that works through the amylin pathway regulating eating behavior. It occupies a special place in modern strategies for metabolic health, fat loss, and active longevity, especially as an incretin peptide enhancer.

General Information

Properties	Values
Peptide Sequence	XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula	C194H312N54O59S2
Molecular Weight	4409 g/mol
Number CAS	1415456-99-3
PubChem CID	171397054
Synonyms	1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N

Lyophilized Peptides
Our Cagrilintide is supplied as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the peptide's purity and integrity without the use of any fillers.

Product Use
This product is for research use only. All product information provided on this website is for educational purposes only.

Peptide purity greater than 99%
Confirmed by certified laboratories. Certificates of Analysis available prior to purchase.

GMR manufacturing standards
Produced in facilities in accordance with Good Manufacturing Practices. Full traceability documentation.

Top-Level Order Fulfillment
Next-day shipping for orders placed before 12:00 PM Moscow time. Free standard shipping across the country on orders over 15,000₽ (or equivalent).

No fillers or additives
Only pure active compounds. Expertly validated formulation for reliable in vitro studies.